DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1c15

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001103370.1 Gene:Akr1c15 / 361267 RGDID:1307514 Length:324 Species:Rattus norvegicus


Alignment Length:337 Identity:126/337 - (37%)
Similarity:187/337 - (55%) Gaps:29/337 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTKFLTFNNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVLKRW 64
            :::.:..|:|..|||:|.||:.:.:.....|.:|   |::.|:||||.|..|.||:.:|:.|:..
  Rat     5 HSRSVKLNDGNLMPVLGFGTFASKEIPKSKAAEATKVAIDVGFRHIDAAYFYQNEEEVGQALRDK 69

  Fly    65 LDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININED------ 123
            :..|.||||:||..||:.....||..|...:::||:.|.||||||.::|.|..:...|:      
  Rat    70 MADGTVKREDLFYTTKIWITFLRPELVRQCLERSLKKLGLDYVDLCIIHIPIAMKPGEELLPKDA 134

  Fly   124 -GSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANN 185
             |.|..|     .||:...    |.|:|...:.||:||||||||:..|:..:|.  ..|.:|..|
  Rat   135 NGKFIFD-----TVDIRDT----WEALEKCKDAGLSKSIGVSNFNHKQLELILNKPRLKYKPTCN 190

  Fly   186 QIEHHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHG 250
            |:|.|.||.|..|::||||::|.:.|||.|||     ....:.:..|.|.|::.|.:..||..|.
  Rat   191 QVECHPYLNQSKLLEFCKSKDIVLVAYSALGS-----HRDSSWVSSDSPYLLEDPVLMTIAKKHN 250

  Fly   251 KTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGV 315
            :||.||.||:.:..||..:.||.|..|:|:|..|||||||.|::..:.||::|.|....||   .
  Rat   251 QTPGQVALRYQLQRGVVVLAKSFNEKRIKENFQVFDFELTPEDMKTIDSLNRNFRYSQMAF---A 312

  Fly   316 ERHPEFTFKNQY 327
            ..||::.|..:|
  Rat   313 LDHPDYPFLEEY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 118/308 (38%)
Tas 10..297 CDD:223739 116/298 (39%)
Akr1c15NP_001103370.1 ARA1 9..306 CDD:223729 119/310 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.