DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1c1

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001028869.1 Gene:Akr1c1 / 307092 RGDID:1306847 Length:323 Species:Rattus norvegicus


Alignment Length:335 Identity:132/335 - (39%)
Similarity:200/335 - (59%) Gaps:21/335 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VNTKFLT--FNNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVL 61
            :|:|..|  .::|..:||:|.||:...:.....|::|   |::||:||||:|.||.|||.:|..:
  Rat     1 MNSKQQTVRLSDGHFIPVLGFGTYAPREVPKSKALEATKIAIDAGFRHIDSAAVYQNEKEVGLAI 65

  Fly    62 KRWLDAGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSF 126
            :..:..|.||||::|..:||....|.|..|:..:::||:.|||:||||||:|.|..:...||...
  Rat    66 RSKIADGTVKREDIFYTSKVWCTFNHPERVQVCLEQSLKQLQLEYVDLYLIHFPMALKPEEDLKA 130

  Fly   127 KLDKEGLM--EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQI 187
            |.:.|.|:  .||:...    |.|||...:.||.||||||||::.|:.::|.  ..|.||..||:
  Rat   131 KDENEKLLFDVVDICDT----WKAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKHRPVCNQV 191

  Fly   188 EHHVYLQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKT 252
            |.|.||.||.|:|||||::|.:.|||.|||....:.     :.:.||.|:..|.:..||..:..|
  Rat   192 ECHPYLNQRKLLDFCKSKDIVLVAYSALGSHRETRC-----VDKSLPVLLADPVLCAIAKKYNWT 251

  Fly   253 PAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVER 317
            ||.:.||:.::.||..:.||....|:|:|:.||:|:||:|::..|..|::|||....:.|.|   
  Rat   252 PALIALRYQLERGVVVLAKSFTEKRIKENMQVFEFQLTSEDMKVLDGLNKNIRYMSGSRFQG--- 313

  Fly   318 HPEFTFKNQY 327
            ||:|.|.::|
  Rat   314 HPDFPFLDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 121/305 (40%)
Tas 10..297 CDD:223739 117/293 (40%)
Akr1c1NP_001028869.1 ARA1 5..305 CDD:223729 122/308 (40%)
Tas 16..297 CDD:223739 116/289 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.