DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1b8

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_775159.1 Gene:Akr1b8 / 286921 RGDID:708475 Length:316 Species:Rattus norvegicus


Alignment Length:324 Identity:132/324 - (40%)
Similarity:196/324 - (60%) Gaps:13/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKV 70
            |:..:...|||::|:|||::...:::.|:.||::|||||||.|..|.||..:|..::..:....|
  Rat     4 FVELSTKAKMPIVGLGTWKSMPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKEKAV 68

  Fly    71 KREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLME 135
            :||:||||:|:.|.......::...:|:|.||:|||:||||:|.|......:: .|..|::|.:.
  Rat    69 RREDLFIVSKLWPTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWPQGFQAGKE-LFPKDEQGNVL 132

  Fly   136 VDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDL 198
            ...||...| |..||.||::||.|::|||||:..|:.|||.  ..|.:|..||:|.|.||.|..|
  Rat   133 PSKTTFLEA-WEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKL 196

  Fly   199 VDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIID 263
            :.:|.|:.|.|||||||||....:...      |.|.|:..|::|||||.|.||.||||:|:.|.
  Rat   197 IQYCHSKGIVVTAYSPLGSPDRPRAKP------DDPSLLQDPKIKEIAAKHKKTTAQVLIRFHIQ 255

  Fly   264 TGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327
            ..|..||||..|||:::|:.||||:|:.:|:|.:.|.::|.|.|.......:|   ||.:..:|
  Rat   256 RNVVVIPKSVTPARIQENIQVFDFQLSDQEMATILSFNRNWRACLLPETVNME---EFPYDAEY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 125/297 (42%)
Tas 10..297 CDD:223739 123/288 (43%)
Akr1b8NP_775159.1 ARA1 1..297 CDD:223729 126/300 (42%)
Tas 16..289 CDD:223739 120/280 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.