DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1c13

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_006516545.1 Gene:Akr1c13 / 27384 MGIID:1351662 Length:324 Species:Mus musculus


Alignment Length:319 Identity:115/319 - (36%)
Similarity:190/319 - (59%) Gaps:15/319 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREEL 75
            :|||..::.|..  ...:.:|.|. .||:.||||:|||..|..|:.||:.::..:.||.||||:|
Mouse    19 DGEKEDLVKINV--PKSKSLEAAC-LALDVGYRHVDTAYAYQVEEEIGQAIQSKIKAGVVKREDL 80

  Fly    76 FIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTT 140
            ||.||:.....||..|:|.::|||:.|||||||||::|.|..:. :.|..|.::::|...:| |.
Mouse    81 FITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYPVPMK-SGDNDFPVNEQGKSLLD-TV 143

  Fly   141 NHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLVDFCK 203
            :....|..:|...:.||.||||||||:..|:.|:|.  ..|.:|..||:|.|:||.||.|:|:|:
Mouse   144 DFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQRKLLDYCE 208

  Fly   204 SENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSA 268
            |::|.:.||..||::...::     :.::.|.|::.|.:.::|..:.::||.:.||::|..|:..
Mouse   209 SKDIVLVAYGALGTQRYKEW-----VDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLIQRGIVP 268

  Fly   269 IPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQY 327
            :.:|.....:::||.||.|:|:.|::..|..|::|.|.....|   :..|||:.|..:|
Mouse   269 LAQSFKENEMRENLQVFGFQLSPEDMKTLDGLNKNFRYLPAEF---LVDHPEYPFVEEY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 107/292 (37%)
Tas 10..297 CDD:223739 105/287 (37%)
Akr1c13XP_006516545.1 AKR_AKR1C1-35 30..309 CDD:381334 105/288 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.