DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr7a3

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_038965272.1 Gene:Akr7a3 / 26760 RGDID:628635 Length:387 Species:Rattus norvegicus


Alignment Length:339 Identity:73/339 - (21%)
Similarity:122/339 - (35%) Gaps:122/339 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AIDAALEAGYRHIDTAPVYGN---EKAIGRVLKRWLDAG--------KVKREELFIVTKVPPV-- 84
            ::.|.|:.|:..||||.||.|   |..:|       |.|        |||     |.||..|:  
  Rat    87 SVRAFLQRGHTEIDTAFVYANGQSETILG-------DLGLGLGRSGCKVK-----IATKAAPMFG 139

  Fly    85 -SNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNHAAIWVA 148
             :.:|.:|...::.||:.||...|||:.:|.|      :.|:         .::.|..      |
  Rat   140 KTLKPADVRFQLETSLKRLQCPRVDLFYLHFP------DHGT---------PIEETLQ------A 183

  Fly   149 MEALVEKGLTKSIGVSNFSKDQVARLLKNCK----IRPANNQIEHHVYLQQ--RDLVDFCKSENI 207
            ...|.::|....:|:||:...:||.:...||    |.|...|..::...:|  .:|....:...:
  Rat   184 CHQLHQEGKFVELGLSNYVSWEVAEICTLCKKNGWIMPTVYQGMYNAITRQVETELFPCLRHFGL 248

  Fly   208 TVTAYSPL---------------GSKGIAKFNA------------------GAGIVRDLPDLMDI 239
            ...|::||               |....::|..                  |..:|.        
  Rat   249 RFYAFNPLAGGLLTGRYKYQDKDGKNPESRFFGNPFSQLYMDRYWKEEHFNGIALVE-------- 305

  Fly   240 PEVKEIAASHGKTPAQVL---LRWII-------DTGVSAIPKSTNPARLKQNL------------ 282
               |.:..::|.|...::   :||:.       ..|.:.|...::..:|:|||            
  Rat   306 ---KALKTTYGPTAPSMISAAVRWMYHHSQLKGTQGDAVILGMSSLEQLEQNLALVEEGPLEPAV 367

  Fly   283 -DVFD--FELTAEE 293
             |.||  :.|.|.|
  Rat   368 VDAFDQAWNLVAHE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 73/339 (22%)
Tas 10..297 CDD:223739 73/339 (22%)
Akr7a3XP_038965272.1 AKR_AKR7A1-5 66..375 CDD:381301 70/331 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.