DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and SPAC26F1.07

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_594888.1 Gene:SPAC26F1.07 / 2542088 PomBaseID:SPAC26F1.07 Length:321 Species:Schizosaccharomyces pombe


Alignment Length:326 Identity:114/326 - (34%)
Similarity:180/326 - (55%) Gaps:33/326 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTKFLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDA 67
            |..| |..:|.|:|.:|:|||::...:.:.|:..||:.||||||.|.:||||..:|..:|   ::
pombe    13 NVHF-TLADGSKIPGLGLGTWRSEPNQTKNAVKTALQYGYRHIDAAAIYGNEDEVGDGIK---ES 73

  Fly    68 GKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEG 132
            | |.|:::::.:|:...::.|..|...::|:|:||:|||:|.||:|.|.:....|| .|..||:|
pombe    74 G-VPRKDIWVTSKLWCNAHAPEAVPKALEKTLKDLKLDYLDEYLIHWPVSFKTGED-KFPKDKDG 136

  Fly   133 LM-----EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVY 192
            .:     .::.|      |.|||.|:|.|..:.||:|||:...:.|:||..|::||.:|:|.|.:
pombe   137 NLIYEKNPIEET------WKAMEKLLETGKVRHIGLSNFNDTNLERILKVAKVKPAVHQMELHPF 195

  Fly   193 LQQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGK--TPAQ 255
            |.|.:.|:..|...|.||||||.|       |........:|.|::...:::||.|.|:  |.|.
pombe   196 LPQTEFVEKHKKLGIHVTAYSPFG-------NQNTIYESKIPKLIEHETIQKIAKSKGEGVTGAT 253

  Fly   256 VLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAF-----FHGV 315
            :.:.|.|..|.|.||||.|..|:|.|...  ..||.|::.:::|:....|.....|     |.|:
pombe   254 IAVSWAITRGTSVIPKSVNEQRIKSNFKY--IPLTKEDMDEINSIGIRARFNQATFSNEPVFAGL 316

  Fly   316 E 316
            |
pombe   317 E 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 108/303 (36%)
Tas 10..297 CDD:223739 105/293 (36%)
SPAC26F1.07NP_594888.1 ARA1 15..302 CDD:223729 108/307 (35%)
Tas 21..303 CDD:223739 107/301 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.