DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and SPAC2F3.05c

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_594384.1 Gene:SPAC2F3.05c / 2541958 PomBaseID:SPAC2F3.05c Length:275 Species:Schizosaccharomyces pombe


Alignment Length:305 Identity:96/305 - (31%)
Similarity:162/305 - (53%) Gaps:53/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKV 70
            |:..|||.|.|....|::..:..:...::.|||:.||||||:|.:|.||...||.:.::::....
pombe     5 FVKLNNGLKCPQFAYGSYMVNRTKCFDSVYAALQCGYRHIDSAQMYHNEADCGRAILKFMEETGT 69

  Fly    71 KREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLME 135
            |||:::..:|:..:|.....:. :|..|::...|.|:||:|:|:|:...|..             
pombe    70 KREDIWFTSKLNDLSGYKSTLS-SIDASVKACGLGYIDLFLLHSPYGDRIES------------- 120

  Fly   136 VDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLL-KNCKIRPANNQIEHHVYLQQRDLV 199
                      |.|:|..||:|..::||||||....:..|| .:.||.|..||||.|.:..|:.:|
pombe   121 ----------WKALEKGVEEGKLRAIGVSNFGPHHIQELLDSHPKIIPCVNQIELHPFCSQQKVV 175

  Fly   200 DFCKSENITVTAYSPL------GSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLL 258
            |:|:|:.|.:.||:||      |:|                      ::..||:.:.|:.||:::
pombe   176 DYCESKGIQLAAYAPLVHGEKFGNK----------------------QLLAIASKYNKSEAQIMI 218

  Fly   259 RWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQN 303
            |:.:..|...:|||:.|.|:|:|.||||||::.|::.||.:||::
pombe   219 RYCLQRGFIVLPKSSTPRRIKENGDVFDFEISKEDMEKLYNLDED 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 95/302 (31%)
Tas 10..297 CDD:223739 91/293 (31%)
SPAC2F3.05cNP_594384.1 ARA1 1..274 CDD:223729 96/305 (31%)
Tas 9..272 CDD:223739 95/301 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.