DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and AKR7L

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001335350.1 Gene:AKR7L / 246181 HGNCID:24056 Length:331 Species:Homo sapiens


Alignment Length:323 Identity:71/323 - (21%)
Similarity:114/323 - (35%) Gaps:117/323 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AALEAGYRHIDTAPVY--GNEKAI--GRVLKRWLDAGKVKREELFIVTKVPP-VSN--RPHEVEP 93
            |.||.|:..||||.:|  |..:.|  |..|:......:||     |.||..| :.|  :|..|..
Human    34 AFLERGHTEIDTAFLYSDGQSETILGGLGLRMGSSDCRVK-----IATKANPWIGNSLKPDSVRS 93

  Fly    94 TIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLT 158
            .::.||:.||...|||:.:|.|             |....:|..:...|        .|.::|..
Human    94 QLETSLKRLQCPRVDLFYLHAP-------------DHSAPVEETLRACH--------QLHQEGKF 137

  Fly   159 KSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVY---------LQQRDLVDFCKSENITVTAYSP 214
            ..:|:||::..:||.:...||   :|..|...||         ..:.:|....:...:...||:|
Human   138 VELGLSNYAAWEVAEICTLCK---SNGWILPTVYQGMYSATTRQVETELFPCLRHFGLRFYAYNP 199

  Fly   215 L---------------GSKGIAKFNA------------------GAGIVRDLPDLMDIPEVKEIA 246
            |               |.:.:.:|..                  |..:|.           |.:.
Human   200 LAGGLLTGKYKYEDKDGKQPVGRFFGTQWAEIYRNHFWKEHHFEGIALVE-----------KALQ 253

  Fly   247 ASHGKTP---AQVLLRWI-------------IDTGVSAIPKSTNPARLKQNLDVFDFELTAEE 293
            |::|.:.   ....|||:             :..|:|::      .:|:|||      ..|||
Human   254 AAYGASAPSMTSAALRWMYHHSQLQGAHGDAVILGMSSL------EQLEQNL------AAAEE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 71/323 (22%)
Tas 10..297 CDD:223739 71/323 (22%)
AKR7LNP_001335350.1 Aldo_ket_red 10..318 CDD:119408 71/323 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.