DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and AKR7A3

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_011539348.1 Gene:AKR7A3 / 22977 HGNCID:390 Length:375 Species:Homo sapiens


Alignment Length:271 Identity:63/271 - (23%)
Similarity:103/271 - (38%) Gaps:78/271 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AALEAGYRHIDTAPVY--GNEKAI--GRVLKRWLDAGKVKREELFIVTKVPPV---SNRPHEVEP 93
            |.||.|:..||||.||  |..:.|  |..|:......:||     |.||..|:   |.:|..:..
Human    34 AFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVK-----IDTKAIPLFGNSLKPDSLRF 93

  Fly    94 TIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLT 158
            .::.||:.||...|||:.:|.|                     |.:|.......|...|.::|..
Human    94 QLETSLKRLQCPRVDLFYLHMP---------------------DHSTPVEETLRACHQLHQEGKF 137

  Fly   159 KSIGVSNFSKDQVARLLKNCK----IRPANNQIEHHVYLQQ--RDLVDFCKSENITVTAYSPL-- 215
            ..:|:||::..:||.:...||    |.|...|..::...:|  .:|....:...:...|::||  
Human   138 VELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAG 202

  Fly   216 -------------GSKGIAKF--NAGAGIVRD------------LPDLMDIPEVKEIAASHGKTP 253
                         |.:.:.:|  |..|.:.|:            |.:       |.:.|::|.:.
Human   203 GLLTGKYKYEDKNGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVE-------KALQAAYGASA 260

  Fly   254 ---AQVLLRWI 261
               ....|||:
Human   261 PSMTSATLRWM 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 63/271 (23%)
Tas 10..297 CDD:223739 63/271 (23%)
AKR7A3XP_011539348.1 Tas 10..270 CDD:223739 61/268 (23%)
Aldo_ket_red 10..>220 CDD:119408 52/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.