DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1d1

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_017176967.1 Gene:Akr1d1 / 208665 MGIID:2384785 Length:328 Species:Mus musculus


Alignment Length:286 Identity:101/286 - (35%)
Similarity:163/286 - (56%) Gaps:18/286 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTFNNGEKMPVIGIGTWQASDE-----EIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLD 66
            ::.::|..:|:||:||:  ||.     :...|:..|::.||||||.|.||.||..:|..::..:.
Mouse    28 ISLSDGNNIPLIGLGTY--SDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIA 90

  Fly    67 AGKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKE 131
            .|||||||:|...|:....:.|..|.|.::::|:.|:|||:|||::..|......:: .:..|:.
Mouse    91 EGKVKREEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMAFKPGKE-IYPRDEN 154

  Fly   132 GLMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQ 194
            |.:..| .||..|.|.|:||..:.||.||:|||||::.|:..:|.  ..|.:|..||:|.|.|..
Mouse   155 GRIIYD-KTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFT 218

  Fly   195 QRDLVDFCKSENITVTAYSPLGS-KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLL 258
            |..|:.||:..:|.:.|:||||: :..:..|..:      |.|::...:..:...:.||.||::|
Mouse   219 QTKLLKFCQQHDIVIVAHSPLGTCRNPSWVNVSS------PPLLNDELLTSLGKKYNKTQAQIVL 277

  Fly   259 RWIIDTGVSAIPKSTNPARLKQNLDV 284
            |:.|..|:..||||..|.|:|:|..|
Mouse   278 RFNIQRGIVVIPKSFTPERIKENFQV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 101/286 (35%)
Tas 10..297 CDD:223739 101/283 (36%)
Akr1d1XP_017176967.1 AKR_SF 33..303 CDD:382030 100/279 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.