DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1c14

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_612556.1 Gene:Akr1c14 / 191574 RGDID:708361 Length:322 Species:Rattus norvegicus


Alignment Length:328 Identity:114/328 - (34%)
Similarity:183/328 - (55%) Gaps:27/328 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTFNNGEKMPVIGIGTW---QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            :..|:|..:||:|.||.   :.:.:|:..|...|::.|:||.|:|.:|..|:.:|:.::..::.|
  Rat     8 VALNDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDG 72

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGL 133
            .||||::|..:|:....:||..|...::|:|:..||||||||::|.|..:... |..|..|:.|.
  Rat    73 TVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPG-DIFFPRDEHGK 136

  Fly   134 MEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQR 196
            :..: |.:....|.|||...:.||.||||||||:..|:.|:|.  ..|.:|..||:|.|:||.|.
  Rat   137 LLFE-TVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQS 200

  Fly   197 DLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRD-------LPDLMDIPEVKEIAASHGKTPA 254
            .::|:|||::|.:.:|..|||.            ||       .|.|:|.|.:..||..:.:|||
  Rat   201 KMLDYCKSKDIILVSYCTLGSS------------RDKTWVDQKSPVLLDDPVLCAIAKKYKQTPA 253

  Fly   255 QVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHP 319
            .|.||:.:..||..:.:|.|..|:|:...||:|:|.:|::..|..|::|.|..:..:|.....||
  Rat   254 LVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNAKYFDDHPNHP 318

  Fly   320 EFT 322
             ||
  Rat   319 -FT 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 107/306 (35%)
Tas 10..297 CDD:223739 105/298 (35%)
Akr1c14NP_612556.1 AKR_AKR1C1-35 7..308 CDD:381334 109/313 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.