DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and C01G5.5

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_500993.1 Gene:C01G5.5 / 182074 WormBaseID:WBGene00015307 Length:287 Species:Caenorhabditis elegans


Alignment Length:297 Identity:93/297 - (31%)
Similarity:148/297 - (49%) Gaps:35/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREEL 75
            ||:::|.:.:||::|..:::..|:|.||:.|||..|||..|.|||.:|..||..|....:..|::
 Worm     6 NGQEIPKLALGTYEAKGDQLFAAVDEALKVGYRSFDTAKYYENEKDLGLALKTLLPRHNICSEDI 70

  Fly    76 FIVTKVPPVS--NRPHEVEPTIKKSLEDLQLDYVDLYLVHTP---FTININEDGS-FKLDKEGLM 134
            ::.:||.|.|  |....:...:.:|||.|...|:||.|||.|   .|.::||:.. ::.|     
 Worm    71 YLTSKVFPYSSKNAAELIRKDVNESLELLDRKYLDLVLVHYPRPLDTEDLNENNKMYRKD----- 130

  Fly   135 EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCKIRPANNQIEHHVYLQQRDLV 199
                      .|:|:|.|..:|..:||||||:....:..:.....|.|..||||:|.:.|::.|.
 Worm   131 ----------TWIALEKLHAEGKIRSIGVSNYEPHHIEEMRSYITIEPQVNQIEYHPHFQRKVLR 185

  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDT 264
            .:|....|...|:||||              |....|:....::.||..|..|.|.|:|.||:..
 Worm   186 AYCNKNEILFQAFSPLG--------------RGNKTLLGDSTMERIALCHKTTVANVILAWIMKG 236

  Fly   265 GVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLD 301
            ....:.||..|:|:.:|......||:.:|..|::.|:
 Worm   237 KYGVVAKSVTPSRVAENYTSLSLELSDDEFEKINGLN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 93/297 (31%)
Tas 10..297 CDD:223739 91/291 (31%)
C01G5.5NP_500993.1 AKR_AKR1-5-like 10..270 CDD:381297 90/288 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.