DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr7a2

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_599234.1 Gene:Akr7a2 / 171445 RGDID:620311 Length:338 Species:Rattus norvegicus


Alignment Length:195 Identity:52/195 - (26%)
Similarity:81/195 - (41%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IDAALEAGYRHIDTAPVY--GNEKAIGRVLKRWLDAG--KVKREELFIVTKVPP---VSNRPHEV 91
            :.|.||.|...:|||.:|  |..::|...|...|.:|  .||     |.||..|   .|.:|..|
  Rat    39 VRAFLERGLNELDTAFMYCDGQSESILGSLGLGLGSGDCTVK-----IATKANPWDGKSLKPDSV 98

  Fly    92 EPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKG 156
            ...::.||:.||...|||:.:|.|                     |..|.......|.:.|.::|
  Rat    99 RSQLETSLKRLQCPRVDLFYLHAP---------------------DHGTPIVETLQACQQLHQEG 142

  Fly   157 LTKSIGVSNFSKDQVARLLKNCK----IRPANNQIEHHVYLQQ--RDLVDFCKSENITVTAYSPL 215
            ....:|:||::..:||.:...||    |.|...|..::...:|  .:|:...:...:...||:||
  Rat   143 KFVELGLSNYASWEVAEIYTLCKSNGWILPTVYQGMYNATTRQVETELLPCLRYFGLRFYAYNPL 207

  Fly   216  215
              Rat   208  207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 52/195 (27%)
Tas 10..297 CDD:223739 52/195 (27%)
Akr7a2NP_599234.1 Tas 21..334 CDD:223739 52/195 (27%)
Aldo_ket_red 21..325 CDD:119408 52/195 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.