DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1b7

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_033861.2 Gene:Akr1b7 / 11997 MGIID:101918 Length:316 Species:Mus musculus


Alignment Length:327 Identity:136/327 - (41%)
Similarity:202/327 - (61%) Gaps:19/327 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKV 70
            |:..:...|||::|:|||::|..:::.|:.||::|||||||.|.||.||..:|..::..:....|
Mouse     4 FVELSTKAKMPLVGLGTWKSSPGQVKEAVKAAIDAGYRHIDCAYVYHNENEVGEAIQEKIKENAV 68

  Fly    71 KREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLME 135
            |||:||||:|:.........|:...:.:|.||:|||:||||||.|...   :.|:..|.|:...:
Mouse    69 KREDLFIVSKLWATFFEKSLVKKAFQNTLSDLKLDYLDLYLVHWPQGF---QAGNALLPKDNKGK 130

  Fly   136 VDVT-TNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRD 197
            |.:: :.....|.|||.||::||.|::|:|||:..|:.|||.  ..|.:|..||||.|.||.|..
Mouse   131 VLLSKSTFLDAWEAMEELVDQGLVKALGISNFNHFQIERLLNKPGLKHKPVTNQIESHPYLTQEK 195

  Fly   198 LVDFCKSENITVTAYSPLGS--KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRW 260
            |:.:|:|:.|.|||||||||  :..||        .:.|.:|:||::|||||.|.||.||||:|:
Mouse   196 LIQYCQSKGIAVTAYSPLGSPDRPYAK--------PEDPVVMEIPKIKEIAAKHKKTVAQVLIRF 252

  Fly   261 IIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKN 325
            .:...|..||||..|:|:::||.||||:|:.|::|.:.|.::|.|.||.......|.:|   |..
Mouse   253 HVQRNVVVIPKSVTPSRIQENLQVFDFQLSEEDMAAILSFNRNWRACDLLDARTEEDYP---FHE 314

  Fly   326 QY 327
            :|
Mouse   315 EY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 128/300 (43%)
Tas 10..297 CDD:223739 126/291 (43%)
Akr1b7NP_033861.2 AKR_AKR1B1-19 10..316 CDD:381333 134/319 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.