DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1b7

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_038962847.1 Gene:Akr1b7 / 116463 RGDID:620257 Length:329 Species:Rattus norvegicus


Alignment Length:306 Identity:121/306 - (39%)
Similarity:183/306 - (59%) Gaps:29/306 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVKREELFIVTKVPPVSNRPHEVEP 93
            :::.|:.||::|||||.|.|.||.||..:|..::..:....|:||:||||:|:.........::.
  Rat    40 QVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWSTFFEKSLMKE 104

  Fly    94 TIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEVDVTTNHAAIWVAMEALVEKGLT 158
            ..:|:|.||:|||:||||:|.|..:...::...| |.:|.:.:..:|...| |..||.||::||.
  Rat   105 AFQKTLSDLKLDYLDLYLIHWPQGLQAGKEFLPK-DSQGKVLMSKSTFLDA-WEGMEELVDQGLV 167

  Fly   159 KSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLVDFCKSENITVTAYSPLGS--KG 219
            |::|||||:..|:.|||.  ..|.:|..||:|.|.||.|..|:.:|.|:.|.|.|||||||  :.
  Rat   168 KALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLGSPDRP 232

  Fly   220 IAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDV 284
            .||        .:.|.:::||::|||||.|.||.||||:|:.:...|:.||||...:.:|:|:.|
  Rat   233 YAK--------PEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSHIKENIQV 289

  Fly   285 FDFELTAEEVAKLSSLDQNIRIC---------DFAFFHGVERHPEF 321
            |||:|:.|::|.:.||::|.|.|         ||.|      |.|:
  Rat   290 FDFQLSEEDMAAILSLNRNWRACGLFVTSDEEDFPF------HEEY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 113/276 (41%)
Tas 10..297 CDD:223739 111/271 (41%)
Akr1b7XP_038962847.1 AKR_SF 35..329 CDD:412396 120/304 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.