DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr7a5

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_079613.3 Gene:Akr7a5 / 110198 MGIID:107796 Length:367 Species:Mus musculus


Alignment Length:340 Identity:79/340 - (23%)
Similarity:131/340 - (38%) Gaps:85/340 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PVIGIGTWQAS---DEEIETA-IDAALEAGYRHIDTAPVY--GNEKAIGRVLKRWLDAG--KVKR 72
            |...:||.:..   |.....| :.|.||.|:..:|||.:|  |..:.|...|...|.:|  .|| 
Mouse    46 PATVLGTMEMGRRMDASASAASVRAFLERGHSELDTAFMYCDGQSENILGGLGLGLGSGDCTVK- 109

  Fly    73 EELFIVTKVPP---VSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLM 134
                |.||..|   .|.:|..:...::.||:.||...|||:.:|.|                   
Mouse   110 ----IATKANPWEGKSLKPDSIRSQLETSLKRLQCPRVDLFYLHAP------------------- 151

  Fly   135 EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLKNCK----IRPANNQIEHHVYLQQ 195
              |.:|.......|...|.::|....:|:||::..:||.:...||    |.|...|..::...:|
Mouse   152 --DHSTPVEETLRACHQLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQ 214

  Fly   196 --RDLVDFCKSENITVTAYSPL---------------GSKGIAKF--NAGAGIVRDL------PD 235
              .:|:...:...:...||:||               |.:.:.:|  |..|...|:.      .:
Mouse   215 VEAELLPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNNWAETYRNRFWKEHHFE 279

  Fly   236 LMDIPEVKEIAASHGKTPAQV---LLRWII-------DTGVSAIPKSTNPARLKQNLDVFDFELT 290
            .:.:.| |.:..::|....::   .|||:.       ..|.:.|...::..:|:|||     ..|
Mouse   280 AIALVE-KALQTTYGTNAPRMTSAALRWMYHHSQLQGTRGDAVILGMSSLEQLEQNL-----AAT 338

  Fly   291 AE---EVAKLSSLDQ 302
            .|   |.|.:.:.||
Mouse   339 EEGPLEPAVVEAFDQ 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 77/338 (23%)
Tas 10..297 CDD:223739 77/333 (23%)
Akr7a5NP_079613.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Tas 46..363 CDD:223739 79/340 (23%)
Aldo_ket_red 46..354 CDD:119408 79/340 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.