DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and Akr1c14

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_598833.1 Gene:Akr1c14 / 105387 MGIID:2145458 Length:323 Species:Mus musculus


Alignment Length:336 Identity:108/336 - (32%)
Similarity:184/336 - (54%) Gaps:35/336 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTFNNGEKMPVIGIGTW---QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68
            :..|:|..:|.:|.||.   :...:|:..|...|::.|:||.|:|.:|..|:.:|:.::..::.|
Mouse     8 VVLNDGHFIPALGFGTTVPDKVPKDELIKATKIAIDTGFRHFDSAYLYQIEEEVGQAIRSKIEDG 72

  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGL 133
            .||||::|..:|:....:||..|...::|:|::.||||||||::|.|..:... |..|..|:.|.
Mouse    73 TVKREDIFYTSKLWSTFHRPELVRSCLEKTLKNAQLDYVDLYIIHFPMALQPG-DKLFPRDEHGK 136

  Fly   134 M---EVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYL 193
            :   .||:...    |.|||...:.||.||||||||:..|:..:|.  ..|.:|..||:|.|:||
Mouse   137 LLAEAVDLCDT----WEAMEKCKDAGLAKSIGVSNFNFRQLETILNKPGLKYKPVCNQVECHLYL 197

  Fly   194 QQRDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRD-------LPDLMDIPEVKEIAASHGK 251
            .|..::|:|||::|.:.:|..|||.            ||       .|.|:|.|.:..:|..:.:
Mouse   198 NQSQMLDYCKSKDIILVSYCTLGSS------------RDKIWVDQKSPVLLDDPVLCAMANKYKQ 250

  Fly   252 TPAQVLLRWIIDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVE 316
            |||.:.:|:.:..|:..:.:|....|:|:.:.||:|:|.:|::..|..|.:|:|....::|   :
Mouse   251 TPALIAIRYQLQRGIVVLTRSFKEKRIKEFMKVFEFQLASEDMKVLDGLHRNLRYNTASYF---D 312

  Fly   317 RHPEFTFKNQY 327
            .||...|.::|
Mouse   313 DHPNHPFTDEY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 101/309 (33%)
Tas 10..297 CDD:223739 99/301 (33%)
Akr1c14NP_598833.1 AKR_AKR1C1-35 6..308 CDD:381334 103/316 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.