DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and LOC101733893

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_031746807.1 Gene:LOC101733893 / 101733893 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:285 Identity:111/285 - (38%)
Similarity:163/285 - (57%) Gaps:20/285 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NNGEKMPVIGIGTW-------QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDA 67
            |:|.||||:|.||:       ..::|..:.|||    .||||||.|.:||||..:||.:|..:..
 Frog    12 NDGHKMPVLGFGTYAPEKFPKSLAEEGTKVAID----VGYRHIDCAFIYGNEVEVGRAIKAKIAD 72

  Fly    68 GKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEG 132
            |.||||::|...|:....:.|..|.|.::|||.||||||:||:::|.|......:| ...||:.|
 Frog    73 GTVKREDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFKPGDD-PLPLDENG 136

  Fly   133 LMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQ 195
             ..:...|:....|.|:|...:.||.:|||||||:..|:..:|.  ..|.:|..||:|.|:||.|
 Frog   137 -KPIFHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECHIYLDQ 200

  Fly   196 RDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRW 260
            ..|::||||::|.:.||..|||.....:     :.:..|.|::.|.:..||..|.:|||.|.:|:
 Frog   201 SKLLEFCKSKDIVLVAYGVLGSSREENW-----VDQSTPVLLENPILGAIAKKHNRTPAHVAMRY 260

  Fly   261 IIDTGVSAIPKSTNPARLKQNLDVF 285
            ::..||..:.||..|||:|:|..||
 Frog   261 LLQRGVVVLAKSFTPARIKENFKVF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 111/285 (39%)
Tas 10..297 CDD:223739 111/285 (39%)
LOC101733893XP_031746807.1 AKR_AKR1C1-35 7..286 CDD:381334 111/285 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.