DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2767 and LOC100494522

DIOPT Version :9

Sequence 1:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_031746808.1 Gene:LOC100494522 / 100494522 -ID:- Length:263 Species:Xenopus tropicalis


Alignment Length:262 Identity:99/262 - (37%)
Similarity:148/262 - (56%) Gaps:20/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NNGEKMPVIGIGTW-------QASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDA 67
            |:|.||||:|.||:       ..::|..:.|||    .||||||.|.:||||..:||.:|..:..
 Frog    12 NDGHKMPVLGFGTYAPEKFPKSLAEEGTKVAID----VGYRHIDCAFIYGNEVEVGRAIKAKIAD 72

  Fly    68 GKVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEG 132
            |.||||::|...|:....:.|..|.|.::|||.||||||:||:::|.|......:| ...||:.|
 Frog    73 GTVKREDVFYTGKLWSTFHTPERVRPALEKSLTDLQLDYMDLFIIHNPVEFKPGDD-PLPLDENG 136

  Fly   133 LMEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQ 195
             ..:...|:....|.|:|...:.||.:|||||||:..|:..:|.  ..|.:|..||:|..:||.|
 Frog   137 -KPIFHNTDLRDTWKALEKCKDAGLVRSIGVSNFNHKQLELILNMPGLKYKPVCNQVECPIYLDQ 200

  Fly   196 RDLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRW 260
            ..|::||||::|.:.||..|||.....:     :.:..|.|::.|.:..||..|.:|||.|.:|:
 Frog   201 SKLLEFCKSKDIVLVAYGVLGSSREENW-----VDQSTPVLLENPILGAIAKKHNRTPAHVAMRY 260

  Fly   261 II 262
            ::
 Frog   261 LL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2767NP_649757.1 ARA1 5..302 CDD:223729 99/262 (38%)
Tas 10..297 CDD:223739 99/262 (38%)
LOC100494522XP_031746808.1 AKR_SF 8..263 CDD:412396 99/262 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.