DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-H and GPI15

DIOPT Version :9

Sequence 1:NP_001262358.1 Gene:PIG-H / 40944 FlyBaseID:FBgn0037535 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_014360.2 Gene:GPI15 / 855690 SGDID:S000004983 Length:229 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:53/229 - (23%)
Similarity:85/229 - (37%) Gaps:71/229 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RQAKYEGAVEADLELCIKHCGGDVVRIELVNRLHGIQLQRKLRRLLLLMFLSIAYFVGTC----- 72
            ::.|..|.||.::                     |||    ..:::|::.|:|.::| .|     
Yeast    45 KKVKQNGRVEINM---------------------GIQ----YHQIVLILLLNILFYV-ICLRSRF 83

  Fly    73 -GFDNRTISFLQPRILYPLITCASVA---ILLIRSTLNLVQAERLFYSWDMALQMETVR------ 127
             ...|||......|....||.....|   |:|:|..  .|:...:|.  :..||:..|:      
Yeast    84 LEHINRTFEVTIARSFQILIIMGLFALGTIILVRGP--SVETVTIFK--ESGLQLSRVKGMVIFP 144

  Fly   128 -SFGR---ESVLCVQRGHIEDIVLNE-------VIEDLDVKYMLILRTKGSQFKKRPIIPLFNSQ 181
             .:.|   |.|..:....|.|:|:||       ||     .|:..:..|.|..|.     ||.|.
Yeast   145 QQWNRKFFEQVEFISNERIIDVVINEGFCRGFRVI-----FYLAAIVRKSSTLKL-----LFPSN 199

  Fly   182 SPSIECLQHTYHVLHKYWLNSTKDRSEESYSKDK 215
            .|||:..:..|::..||     ..:.|:..|:.|
Yeast   200 LPSIDDQRLIYNISRKY-----LSKQEKPLSRPK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-HNP_001262358.1 PIG-H 121..178 CDD:313419 17/73 (23%)
GPI15NP_014360.2 PIG-H 123..197 CDD:401989 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105076
Panther 1 1.100 - - LDO PTHR15231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.