DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-H and AT4G35530

DIOPT Version :9

Sequence 1:NP_001262358.1 Gene:PIG-H / 40944 FlyBaseID:FBgn0037535 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_195278.2 Gene:AT4G35530 / 829705 AraportID:AT4G35530 Length:195 Species:Arabidopsis thaliana


Alignment Length:158 Identity:36/158 - (22%)
Similarity:64/158 - (40%) Gaps:25/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LVNRLHGIQLQRKLRRLLLLMFL-SIAYFVGTCGFDN--RTISFLQPRILYPLITCASVAILLIR 102
            ::|...|....|:......|:|| |..||:  .|.||  ||:|:          .|.....|::.
plant    32 IINGSSGTGYARRWGLGFFLVFLASSMYFL--LGKDNPARTLSW----------GCLLSGFLVML 84

  Fly   103 STLNLVQAERLFYSWDMALQMETVRSFGRESVLCVQRGHIEDIVLNEVIEDLDVKYMLILRTKGS 167
            .:...|:.|.:.......:|:||....|:.....:....|...||.|.:..:...:.|.|..:|.
plant    85 HSRKFVKKESVIILPTFGIQLETQYLSGKTVSRFIPIDKILKPVLVECVTPITCYWSLSLFLRGE 149

  Fly   168 Q-----FKK-RP----IIPLFNSQSPSI 185
            :     ||: ||    ::|::.:...:|
plant   150 EQLTLVFKELRPPLKMLVPIWKALCAAI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-HNP_001262358.1 PIG-H 121..178 CDD:313419 16/66 (24%)
AT4G35530NP_195278.2 PIG-H 94..157 CDD:401989 11/62 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4551
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006238
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105076
Panther 1 1.100 - - LDO PTHR15231
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.860

Return to query results.
Submit another query.