DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-H and pigh

DIOPT Version :9

Sequence 1:NP_001262358.1 Gene:PIG-H / 40944 FlyBaseID:FBgn0037535 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001002565.1 Gene:pigh / 436838 ZFINID:ZDB-GENE-040718-303 Length:181 Species:Danio rerio


Alignment Length:108 Identity:24/108 - (22%)
Similarity:52/108 - (48%) Gaps:6/108 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ITCASVAILLIRSTLNL----VQAERLFYSWDMALQMETVRSFGRESVLCVQRGHIEDIVLNEVI 151
            :..:::.:.|:...:::    |..|.|.....:.:|:.:..:.||||...::...::|||:||.:
Zfish    63 VLSSAIILTLVGMVIHIHFVKVDHETLLIIGSLGVQLSSSYASGRESTTFIEMSKLKDIVINEAV 127

  Fly   152 EDLDVKYML--ILRTKGSQFKKRPIIPLFNSQSPSIECLQHTY 192
            ...::.|.|  :::..........::|||.|..|.:.||...|
Zfish   128 YMHNIIYYLCILIKDPADPETVTSVVPLFQSSKPRLNCLIQVY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-HNP_001262358.1 PIG-H 121..178 CDD:313419 13/58 (22%)
pighNP_001002565.1 PIG-H 89..157 CDD:287190 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4551
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431299at2759
OrthoFinder 1 1.000 - - FOG0006238
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105076
Panther 1 1.100 - - LDO PTHR15231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.