DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-H and Pigh

DIOPT Version :10

Sequence 1:NP_649755.1 Gene:PIG-H / 40944 FlyBaseID:FBgn0037535 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001102184.1 Gene:Pigh / 362756 RGDID:1311438 Length:188 Species:Rattus norvegicus


Alignment Length:137 Identity:32/137 - (23%)
Similarity:57/137 - (41%) Gaps:33/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 MFLSIAYFV---GTCGFDNRTISFLQPRILYPLITCASVAILLIRSTLNLVQAERLFYSWDMALQ 122
            |.||.|.|:   |..|:    :.|::                        :..|.|.....:.:|
  Rat    63 MILSAAIFITILGLLGY----LHFVK------------------------IDQETLLIIDSLGIQ 99

  Fly   123 METVRSFGRESVLCVQRGHIEDIVLNEVIEDLDVKYML--ILRTKGSQFKKRPIIPLFNSQSPSI 185
            |.:..:.|:||...::...::||::||.|....|.|.|  :|:..|...:...::|:|.|..|.:
  Rat   100 MTSSYASGKESTTFIEMNKVKDIIINEAIYMQKVIYYLCILLKDPGKPHEISQVVPVFQSAKPRL 164

  Fly   186 ECLQHTY 192
            :||...|
  Rat   165 DCLIEIY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-HNP_649755.1 None
PighNP_001102184.1 PIG-H 89..158 CDD:462983 17/68 (25%)

Return to query results.
Submit another query.