DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-H and pigh

DIOPT Version :9

Sequence 1:NP_001262358.1 Gene:PIG-H / 40944 FlyBaseID:FBgn0037535 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_002931526.1 Gene:pigh / 100135232 XenbaseID:XB-GENE-5857018 Length:188 Species:Xenopus tropicalis


Alignment Length:109 Identity:30/109 - (27%)
Similarity:51/109 - (46%) Gaps:3/109 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ILYPLITCASVAILLIRSTLNLVQAERLFYSWDMALQMETVRSFGRESVLCVQRGHIEDIVLNEV 150
            :|...|.|....:||....:.:.| |.|.....:.:|:.|..:.|:||.:.::...::|:|:||.
 Frog    63 VLSAAIICTICGLLLYLHFMKIDQ-ESLLLIGSLGIQLTTSFASGKESTVFIEMCRVKDVVINEA 126

  Fly   151 IEDLDVKYMLILRTKGSQFKKR--PIIPLFNSQSPSIECLQHTY 192
            .....|.|.|.:..|.....|.  .|:|:|.|..|.::||...|
 Frog   127 FFMQKVVYYLCILLKDPTDPKEISEIVPVFQSSKPRMDCLTDVY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-HNP_001262358.1 PIG-H 121..178 CDD:313419 16/58 (28%)
pighXP_002931526.1 PIG-H 88..157 CDD:370862 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431299at2759
OrthoFinder 1 1.000 - - FOG0006238
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.