DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and ELOVL3

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_689523.1 Gene:ELOVL3 / 83401 HGNCID:18047 Length:270 Species:Homo sapiens


Alignment Length:263 Identity:67/263 - (25%)
Similarity:112/263 - (42%) Gaps:49/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFS------AW--------- 79
            ::.||   |:|.|..::.| |...|:.||.|.|:..||:::....|||      .|         
Human    35 ATSFP---IALIYLVLIAV-GQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLT 95

  Fly    80 --LFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVS 142
              |....|...:::...::.                ..|.:..||..|..||.|.::|||  .:.
Human    96 GGLKQTVCFINFIDNSTVKF----------------WSWVFLLSKVIELGDTAFIILRKR--PLI 142

  Fly   143 TLHVIHHGIMPVSVWWGVK-FTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLT 206
            .:|..||..:.|...:|.| ..|.|  .:|..:|..||..||.||.|.|...|..|.|  ...:|
Human   143 FIHWYHHSTVLVYTSFGYKNKVPAG--GWFVTMNFGVHAIMYTYYTLKAANVKPPKML--PMLIT 203

  Fly   207 VMQMIQ-FVLVMVHSFQLFFKND--CNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKAS 268
            .:|::| ||..:|......::.|  |:..:...::.....:.::.||::|:.:.|::  .|.||.
Human   204 SLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIR--PKVKAK 266

  Fly   269 VKA 271
            .|:
Human   267 TKS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 64/256 (25%)
ELOVL3NP_689523.1 ELO 29..266 CDD:307345 65/258 (25%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03203 266..270 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.