DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and HOS3-1

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:178 Identity:40/178 - (22%)
Similarity:69/178 - (38%) Gaps:33/178 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LIVYNAAQVIFSAWLFYESCIG---GWLNGYNLRCEPVNYSYSPKAIRTAEGCWW---YYFSKFT 124
            :::..||::..:.||:..|...   .|     |.|.|:....|.:..      :|   :|.::|.
plant    89 ILLSAAAEIRDTRWLWRRSKTATPLQW-----LLCFPLGTRPSGRVF------FWSYVFYLTRFL 142

  Fly   125 EFFDTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLA 189
            ..|.|.|.|:|.|...||.|..  :.:|..:.:..::|:. .:........|.|:..:|.|....
plant   143 HMFRTIFAVLRSRRLAVSQLFC--NSVMAFTSFLWLEFSQ-SYQILAILSTTLVYSVVYGYRFWT 204

  Fly   190 AMGPKVQKYLWWKKYLTVMQMIQFVLV----MVHSFQL---FFKNDCN 230
            ..|      |....:.:.:...|.|||    :.|:..|   .||..||
plant   205 GFG------LPGSAFPSFVVNCQLVLVGCNLVSHAGVLTMHLFKGGCN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 40/178 (22%)
HOS3-1NP_001329164.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.