DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and AT3G06470

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_187298.1 Gene:AT3G06470 / 819824 AraportID:AT3G06470 Length:278 Species:Arabidopsis thaliana


Alignment Length:171 Identity:56/171 - (32%)
Similarity:78/171 - (45%) Gaps:39/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 WW---YYFSKFTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPVS--VWWGVKFTPGGHSTFFGF-- 173
            :|   :|.||..||.||...::.|...::|.|||.||..:.|.  :|...:      .:.|..  
plant   122 FWAQVFYLSKILEFGDTILIILGKSIQRLSFLHVYHHATVVVMCYLWLRTR------QSMFPIAL 180

  Fly   174 -LNTFVHIFMYAYYMLAAMG--PKVQKYLWWKKYLTVMQMIQFVLVMVHSFQL--------FFKN 227
             .|:.||:.||.||.|.|:|  ||      ||:.:|..|::|||.    ||.|        .|.:
plant   181 VTNSTVHVIMYGYYFLCAVGSRPK------WKRLVTDCQIVQFVF----SFGLSGWMLREHLFGS 235

  Fly   228 DCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKR----DGK 264
            .|....|:. |..|.......|||||:.:.|||:    |||
plant   236 GCTGIWGWC-FNAAFNASLLALFSNFHSKNYVKKPTREDGK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 56/171 (33%)
AT3G06470NP_187298.1 ELO 43..272 CDD:395916 53/166 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3313
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.