DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and ELOVL6

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001124193.1 Gene:ELOVL6 / 79071 HGNCID:15829 Length:265 Species:Homo sapiens


Alignment Length:245 Identity:67/245 - (27%)
Similarity:111/245 - (45%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GPKLMENRKPFELRKVLIVYNAAQVIFS--------AWLFY---------ESCIGGWLNGYNLRC 97
            |..||..|..|||||.|::::....:||        |::.|         ..|..|:.||     
Human    47 GRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNG----- 106

  Fly    98 EPVNYSYSPKAIRTAEGCWWYYF--SKFTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGV 160
             ||:            ..|.|.|  ||..|..||.|.::||:  ::..||..||..:.:..|:..
Human   107 -PVS------------KFWAYAFVLSKAPELGDTIFIILRKQ--KLIFLHWYHHITVLLYSWYSY 156

  Fly   161 K-FTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQFVLVMVHSFQLF 224
            | ...||  .:|..:|..||..||:||.|.|.|.:|.:.  :..::|:.|:.|.::..|.::.:|
Human   157 KDMVAGG--GWFMTMNYGVHAVMYSYYALRAAGFRVSRK--FAMFITLSQITQMLMGCVVNYLVF 217

  Fly   225 --FKND-CNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKASVKA 271
              .::| |:......::.....:.:..||.:|:..||:   ||.:.:.||
Human   218 CWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYI---GKMRKTTKA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 65/238 (27%)
ELOVL6NP_001124193.1 ELO 25..260 CDD:395916 65/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.