DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl8a

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001070061.1 Gene:elovl8a / 767653 ZFINID:ZDB-GENE-060929-240 Length:268 Species:Danio rerio


Alignment Length:252 Identity:112/252 - (44%)
Similarity:166/252 - (65%) Gaps:5/252 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LMDNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSA 78
            :::| .|.||..:.|:.||.|...|.|.|..:| ..|||||.:|:|..::.:||:||.:.|..||
Zfish    19 ILEN-GDKRTDGWLLVYSPLPVGGIFLCYLVMV-WFGPKLMVHREPVNIQALLIIYNFSMVCLSA 81

  Fly    79 WLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVST 143
            ::|||..:..||..|:|.|:||:|:.:|..:|.|..|||:||||..|..||.||::||:.:|::.
Zfish    82 YMFYEFTVSSWLASYSLLCQPVDYTENPLPMRMARVCWWFYFSKVIELADTMFFILRKKNNQLTF 146

  Fly   144 LHVIHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVM 208
            |||.|||.|..:.|.|||:..||.|...|.:|:|||:.||.||.|||:||::|||||||:|||.:
Zfish   147 LHVYHHGTMIFNWWAGVKYVAGGQSFLIGLINSFVHVVMYMYYGLAALGPQMQKYLWWKRYLTSL 211

  Fly   209 QMIQFVLVMVH-SFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGK 264
            |::||.:|.:| :|.|:  .||::|......:..:|:....||||||.::|:.:..|
Zfish   212 QLLQFFIVTIHTAFNLY--ADCDFPDSMNMVVLGYALSLIALFSNFYYQSYLSKKTK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 108/239 (45%)
elovl8aNP_001070061.1 ELO 35..266 CDD:279492 106/233 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.