DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and Elovl1

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001037740.1 Gene:Elovl1 / 679532 RGDID:1587151 Length:279 Species:Rattus norvegicus


Alignment Length:267 Identity:122/267 - (45%)
Similarity:172/267 - (64%) Gaps:5/267 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WRDLMDNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVI 75
            :::|| ..:|||.::||||.||....:|.|||.|.|..|||::|.|||||:||..:||||.:.|.
  Rat     8 YQELM-KCADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVT 71

  Fly    76 FSAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQ 140
            .|.::.||..:.|||:.|..||:||::|.:|:|:|.....|.:..||..|..||..|::||:..|
  Rat    72 LSLYIVYEFLMSGWLSTYTWRCDPVDFSNNPEALRMVRVAWLFMLSKVIELMDTVIFILRKKDGQ 136

  Fly   141 VSTLHVIHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYL 205
            |:.|||.||.::|.|.|||:|..|||..:|...:|:.||:.||.||.|:|:||..|.||||||::
  Rat   137 VTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHM 201

  Fly   206 TVMQMIQFVLVMVHSFQLFFKNDCN--YPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKAS 268
            |.:|:||||||.:|..|.:|...||  ||| ..:.|..:..:|:.|||||:..:|.|.....:| 
  Rat   202 TAIQLIQFVLVSLHISQYYFMPSCNYQYPI-IIHLIWMYGTIFFILFSNFWYHSYTKGKRLPRA- 264

  Fly   269 VKANGHA 275
            |:.||.|
  Rat   265 VQQNGAA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 111/240 (46%)
Elovl1NP_001037740.1 ELO 23..260 CDD:395916 111/237 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341357
Domainoid 1 1.000 275 1.000 Domainoid score I1683
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 288 1.000 Inparanoid score I2734
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9039
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.950

Return to query results.
Submit another query.