DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and ELOVL4

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_073563.1 Gene:ELOVL4 / 6785 HGNCID:14415 Length:314 Species:Homo sapiens


Alignment Length:287 Identity:125/287 - (43%)
Similarity:181/287 - (63%) Gaps:14/287 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYE 83
            :|.|..::|||.||:||::||..|...| .||||.|::|:||::|.|||:||...|:.:.::|.|
Human    33 ADKRVENWPLMQSPWPTLSISTLYLLFV-WLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRE 96

  Fly    84 SCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVIH 148
            ..:|.:..||:..|:.|:||.:...:|.|...|||:.||..|:.||.||::||:.:|||.|||.|
Human    97 LFMGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYH 161

  Fly   149 HGIMPVSVWW-GVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQ 212
            |..| .::|| |:|:..||.:.|...||:|:|:.||:||.|.|.||.:|||||||:|||::|:||
Human   162 HCTM-FTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQ 225

  Fly   213 FVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKASVKA-NG-HA 275
            |.:.:.|: .|....||.:|....:.:.|:|:.|.|||.|||.|.| |...|.||...| || .|
Human   226 FHVTIGHT-ALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTY-KEPKKPKAGKTAMNGISA 288

  Fly   276 NGHVKA-----LKDGDVAPTSNGQANG 297
            ||..|:     :::|  ....||:|.|
Human   289 NGVSKSEKQLMIENG--KKQKNGKAKG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 109/239 (46%)
ELOVL4NP_073563.1 ELO 41..278 CDD:279492 109/240 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..314 15/41 (37%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204 310..314 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.