DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and ELOVL5

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:310 Identity:111/310 - (35%)
Similarity:160/310 - (51%) Gaps:49/310 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYES 84
            |.|.:.:.|:.:..||...|:.|..|| .||||.|.|::||..|.:|:|||....:.|.::|.||
Human    20 DTRVKGWFLLDNYIPTFICSVIYLLIV-WLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCES 83

  Fly    85 ---------C------------------IGGWLNGYNLRCEPVNYS--YSPKAIRTAEGCWWYYF 120
                     |                  .|.|...||..|:....:  ...|.||.   .|||||
Human    84 KREQPRRSACASRTDPSTQQQLPENRLVTGVWEGKYNFFCQGTRTAGESDMKIIRV---LWWYYF 145

  Fly   121 SKFTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGV-KFTPGGHSTFFGFLNTFVHIFMYA 184
            ||..||.|||||::||...|::.|||.||..| :::||.| .:.|.|||.|...||:|:|:.||:
Human   146 SKLIEFMDTFFFILRKNNHQITVLHVYHHASM-LNIWWFVMNWVPCGHSYFGATLNSFIHVLMYS 209

  Fly   185 YYMLAAMGPKVQKYLWWKKYLTVMQMIQFVLVMVH-SFQLFFKNDCNYPIGFAYFIGAHAVMFYF 248
            ||.|::: |.::.|||||||:|..|::||||.::. |..:.:  .|.:|:|:.||...:.:....
Human   210 YYGLSSV-PSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIW--PCTFPLGWLYFQIGYMISLIA 271

  Fly   249 LFSNFYKRAYVKRDGKDKASVKANGHANGHVKALKDGDVAPTSNGQANGF 298
            ||:|||.:.|.|: |..:.......|.||.:.|:         ||..|.|
Human   272 LFTNFYIQTYNKK-GASRRKDHLKDHQNGSMAAV---------NGHTNSF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 101/269 (38%)
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 101/269 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.