DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl8b

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001019609.2 Gene:elovl8b / 554145 ZFINID:ZDB-GENE-050522-453 Length:264 Species:Danio rerio


Alignment Length:255 Identity:120/255 - (47%)
Similarity:169/255 - (66%) Gaps:7/255 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WRDLMDNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVI 75
            |  :::| .|.||..:.|:.||.|.|.|.|.|..::.: |||||:|.:|..|:.:|||||.:.|.
Zfish    14 W--IVEN-GDKRTDPWLLVYSPVPIICIFLCYLGVIWI-GPKLMKNMEPVNLKGLLIVYNFSMVG 74

  Fly    76 FSAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQ 140
            .|.::|:|..:..||..|:..|:||:||.||..:|.|..|||::|||..|..||.||::||:..|
Zfish    75 LSVYMFHEFLVTSWLANYSYLCQPVDYSTSPLGMRMANVCWWFFFSKVIELSDTVFFILRKKNSQ 139

  Fly   141 VSTLHVIHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYL 205
            ::.|||.|||.|..:.|.|||:..||.|.|.|.|||||||:||:||.|||:||.:|||||||:||
Zfish   140 LTFLHVYHHGTMIFNWWAGVKYVAGGQSFFIGLLNTFVHIWMYSYYGLAALGPHLQKYLWWKRYL 204

  Fly   206 TVMQMIQFVLVMVHS-FQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGK 264
            |.:|::||:|:.||: :.||  .:|.:|......:.|:.|....||||||.::|:||..|
Zfish   205 TSLQLVQFILLTVHTGYNLF--TECEFPDSMNAVVFAYCVSLIILFSNFYYQSYIKRKSK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 115/239 (48%)
elovl8bNP_001019609.2 ELO 31..264 CDD:279492 114/235 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.