DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl6

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001017257.2 Gene:elovl6 / 550011 XenbaseID:XB-GENE-942876 Length:265 Species:Xenopus tropicalis


Alignment Length:229 Identity:62/229 - (27%)
Similarity:106/229 - (46%) Gaps:29/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GPKLMENRKPFELRKVLIVYNAAQVIFS--------AWLFYESCIGGWLNGYNLRCEPVNYSYSP 106
            |..||:.|:.|||||.||:::.:..:||        |::.|.....|.....   |:. ::.|.|
 Frog    47 GRHLMKQREKFELRKPLILWSLSLAVFSIFGAVRTGAYMLYILMTKGLKQSV---CDQ-SFYYGP 107

  Fly   107 KAIRTAEGCWWYYF--SKFTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGVK-FTPGGHS 168
                 ....|.|.|  ||..|..||.|.::||:  ::..||..||..:.:..|:..| ...||  
 Frog   108 -----VSKFWAYAFVLSKAPELGDTIFIILRKQ--KLIFLHWYHHITVLLYSWYSYKDMVAGG-- 163

  Fly   169 TFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQFVLVMVHSFQLFF---KNDCN 230
            .:|..:|..||..||:||.|.|.|.:|.:.  :...:|:.|:.|.::..|.::.:|.   :..|.
 Frog   164 GWFMTMNYGVHAVMYSYYALRAAGFRVSRK--FAMLITLSQITQMIIGCVVNYLVFSWMQQGQCP 226

  Fly   231 YPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGK 264
            ..:....:.....:.::.||.:|:..||:.:..|
 Frog   227 SHVQNIVWSSIMYLSYFVLFCHFFFEAYITKTRK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 62/229 (27%)
elovl6NP_001017257.2 ELO 25..262 CDD:366492 62/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.