DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and Elovl2

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_038951934.1 Gene:Elovl2 / 498728 RGDID:1308605 Length:296 Species:Rattus norvegicus


Alignment Length:288 Identity:114/288 - (39%)
Similarity:159/288 - (55%) Gaps:13/288 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDYLTMFYDGWRDLMDN---KSDPRTRDYPLMSSPFPTIAISLTYAYIVKV-LGPKLMENRKPFE 61
            |:.|..|.:.....:||   ..|.|.|.:.|:.|..||  .:||..|::.: ||.|.|:||....
  Rat     1 MEQLKAFDNEVNAFLDNMFGPRDSRVRGWFLLDSYLPT--FTLTIVYLLSIWLGNKYMKNRPALS 63

  Fly    62 LRKVLIVYNAAQVIFSAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEF 126
            ||.:|.:||....:.||::..|..:..|..||||:|:.:: |.....||.|:..|||||||..||
  Rat    64 LRGILTLYNLGITLLSAYMLVELVLSSWEGGYNLQCQNLD-SAGEGDIRVAKVLWWYYFSKLVEF 127

  Fly   127 FDTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGV-KFTPGGHSTFFGFLNTFVHIFMYAYYMLAA 190
            .||.|||:||:..|::.|||.||..| .::||.| .:.|.|.|.|...||:|:||.||:||.|:.
  Rat   128 LDTIFFVLRKKTSQITFLHVYHHASM-FNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSV 191

  Fly   191 MGPKVQKYLWWKKYLTVMQMIQFVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYK 255
            . |.:.:|||||||||..|::||||.:.|:.....| .|.:|.|...|..::.:....||.|||.
  Rat   192 F-PSMHRYLWWKKYLTQAQLVQFVLTITHTLSAVVK-PCGFPFGCLIFQSSYMMTLVILFLNFYI 254

  Fly   256 RAYVKRDGKDKASVKANGH--ANGHVKA 281
            :.|.|:..|.:....|.|.  .||..||
  Rat   255 QTYRKKPMKKEMPEGAAGKEVKNGFPKA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 100/240 (42%)
Elovl2XP_038951934.1 ELO 30..264 CDD:395916 99/239 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.