DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl5

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001011248.1 Gene:elovl5 / 496694 XenbaseID:XB-GENE-952346 Length:295 Species:Xenopus tropicalis


Alignment Length:324 Identity:121/324 - (37%)
Similarity:170/324 - (52%) Gaps:37/324 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDYLTMFYDGWRDLMDNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKV 65
            |:.|....:|:.|.:....|||.|.:.|:.:..|||..:..|.:|| ..|||.|:||.|...|.:
 Frog     1 MEVLDKAVNGYIDHLLGPKDPRVRGWLLLDNYVPTILFTALYLFIV-WRGPKYMQNRPPVSCRGI 64

  Fly    66 LIVYNAAQVIFSAWLFYESCIGGWLNGYNLRCEPVNY--SYSPKAIRTAEGCWWYYFSKFTEFFD 128
            |:|||....:.|.::|||...|.|..|||..|:..|.  ....|.:|.   .|||||||..||.|
 Frog    65 LVVYNLGLTLLSLYMFYELVTGVWEGGYNFFCQDTNSGGDADTKIVRV---LWWYYFSKLIEFMD 126

  Fly   129 TFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGV-KFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMG 192
            ||||::||...|::.|||.||..| :::||.| .:.|.|||.|...||:|:|:.||:||.|:|: 
 Frog   127 TFFFILRKNNHQITVLHVYHHASM-LNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSAI- 189

  Fly   193 PKVQKYLWWKKYLTVMQMIQFVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRA 257
            |.::.|||||||:|..|:.||||.|..:...... .|.:|:|:.||...:.:....||.|||.:.
 Frog   190 PAMRPYLWWKKYITQCQLTQFVLTMTQTTCAMIW-PCKFPMGWLYFQNCYMISLIILFGNFYIKT 253

  Fly   258 YVKRDGKDKASVKANGHANGHVKALKDGDVAPTSNGQANGFHNTFSKFTTDMCNPALNSSTRQR 321
            |.|     |.|.:...:.||...|:             ||..|:||         :|..:.:||
 Frog   254 YNK-----KTSSRRKEYQNGSASAV-------------NGHTNSFS---------SLEDNVKQR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 100/241 (41%)
elovl5NP_001011248.1 ELO 28..261 CDD:366492 102/244 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.