DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl1a

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001005989.1 Gene:elovl1a / 449816 ZFINID:ZDB-GENE-041010-66 Length:315 Species:Danio rerio


Alignment Length:309 Identity:136/309 - (44%)
Similarity:181/309 - (58%) Gaps:30/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WRDLMDNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVI 75
            :.|.:..::|.|.||||||.||.....|.|.|.:.|..:||:.|.:||||.|...:|.||...|.
Zfish    12 FHDYLLKRTDARVRDYPLMQSPILMTFILLGYVFSVLYVGPRYMASRKPFRLNTAMIAYNFFMVA 76

  Fly    76 FSAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQ 140
            |:|:..||..:.||...|..||:..:.|.||:|:|.....|.:||||:.|..||.|||:||::.|
Zfish    77 FNAYTVYEFLMSGWATTYTWRCDLCDPSSSPQALRMVRAAWLFYFSKYIELLDTVFFVLRKKHSQ 141

  Fly   141 VSTLHVIHHGIMPVSVWWGVKFTP-GGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKY 204
            |:.||:.||.::|.:.|||:..|| ||..:|...:|..||:.||.||.|||.||:.|||||||||
Zfish   142 VTFLHIFHHSVLPWTWWWGITLTPAGGMGSFHALVNACVHVIMYTYYGLAAAGPRFQKYLWWKKY 206

  Fly   205 LTVMQMIQFVLVMVHSFQLFFKNDCNY--PIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGK--- 264
            :|.:|:||||||..|..|.:|...|:|  || |.:.|..:...|:.|||||:.:||:|  ||   
Zfish   207 MTAIQLIQFVLVTGHISQYYFMEKCDYQVPI-FIHLILIYGTFFFILFSNFWIQAYIK--GKRLP 268

  Fly   265 ----DKASVKANG---------HANGHVKALKDGDVAPTSNGQANGFHN 300
                ||.  |.||         .|||  |.|::|: |..|||.|   ||
Zfish   269 VSNEDKP--KRNGVITVIDPVVVANG--KHLENGN-AHYSNGFA---HN 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 112/248 (45%)
elovl1aNP_001005989.1 ELO 28..266 CDD:279492 111/240 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581305
Domainoid 1 1.000 272 1.000 Domainoid score I1758
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 284 1.000 Inparanoid score I2846
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm6458
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.