DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl7

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001005456.1 Gene:elovl7 / 448054 XenbaseID:XB-GENE-942805 Length:299 Species:Xenopus tropicalis


Alignment Length:288 Identity:134/288 - (46%)
Similarity:178/288 - (61%) Gaps:15/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MFYDGWRDLMDNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYN 70
            :.||.|  :.|  :|||..|:||||:|.|...|...|.|.|..|||::|||||||.|::::..||
 Frog    12 LLYDEW--IKD--ADPRVEDWPLMSTPIPQTIIIGAYIYFVTSLGPRIMENRKPFALKEIMACYN 72

  Fly    71 AAQVIFSAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMR 135
            ...|:||.::.||..:.||..||:.||:.|:||.||:|:|.|..||.:|||||.|..||.|||:|
 Frog    73 LFMVLFSLYMCYEFLMSGWAAGYSYRCDIVDYSQSPQALRMAWTCWLFYFSKFIELLDTVFFVLR 137

  Fly   136 KRYDQVSTLHVIHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLW 200
            |:..|::.|||.||.|||.:.|:||||..||..||...:|..||:.||:||.|:|:||..|||||
 Frog   138 KKNSQITFLHVYHHSIMPWTWWFGVKFAAGGLGTFHALVNCVVHVIMYSYYGLSALGPAYQKYLW 202

  Fly   201 WKKYLTVMQMIQFVLVMVHSFQLFFKNDC--NYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDG 263
            ||||:|.:|:.||::|..|..|.||..:|  .||| |.|.|..:..:|..||.||:..||.|  |
 Frog   203 WKKYMTSIQLTQFLMVTFHIGQFFFMENCPYQYPI-FLYVIWLYGFVFLLLFLNFWFHAYTK--G 264

  Fly   264 KDKASVKANGHA------NGHVKALKDG 285
            :.......|||.      |...|..::|
 Frog   265 QRLPKNLQNGHCKNNNQENAQCKNQRNG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 120/240 (50%)
elovl7NP_001005456.1 ELO 29..228 CDD:395916 103/198 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 257 1.000 Domainoid score I1973
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H23672
Inparanoid 1 1.050 277 1.000 Inparanoid score I2866
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9457
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.