DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and zgc:92749

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001002570.1 Gene:zgc:92749 / 436843 ZFINID:ZDB-GENE-040718-309 Length:266 Species:Danio rerio


Alignment Length:255 Identity:73/255 - (28%)
Similarity:118/255 - (46%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFS-------AW-LFYESCIGGWLN 91
            :..:|.|||.:: .||...|::|:..:||..|::::.:..:||       .| :|...|..|:..
Zfish    30 SFVLSGTYAVLI-FLGHMFMKDRQKLDLRAPLVLWSMSLAVFSIVGTLRTGWYMFNVVCSEGFRQ 93

  Fly    92 GYNLRCEPVNYSYSPKAIRTAEGCWWYYF--SKFTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPV 154
            ..   |:...|| :|     ....|.:.|  ||..|..||.|.|:||:  ::..||..||..:.:
Zfish    94 SV---CDTDFYS-AP-----VSKFWAFAFAISKAPELGDTVFVVLRKQ--RLIFLHWYHHITVLL 147

  Fly   155 SVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQF-----V 214
            ..|:..|....|...|.. :|..||.|||:||...|.|.:|.:.  :...:||:|:.|.     |
Zfish   148 YSWFSYKDHVAGGGWFMS-MNFTVHAFMYSYYTAKAAGVRVPRA--FAMLITVLQISQMAAGLTV 209

  Fly   215 LVMVHSF---QLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKR-DGKDKASVK 270
            |.:|:|:   |.....|.|...|.|.:..     :..||..|:.::|::| ||..|..:|
Zfish   210 LGLVYSWKHEQHCKSTDNNIIFGSAMYFS-----YLPLFCAFFYQSYIRRSDGGQKRRLK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 71/249 (29%)
zgc:92749NP_001002570.1 ELO 22..255 CDD:279492 68/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.