DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and CG33110

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster


Alignment Length:267 Identity:124/267 - (46%)
Similarity:171/267 - (64%) Gaps:13/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLTMFYDG-----WRDLMDNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFEL 62
            ::|..|.|     ::.:.::..|||.:.:|||..|..|..:...|...|.|:||..|.:||||:|
  Fly    32 HITRNYTGLVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQL 96

  Fly    63 RKVLIVYNAAQVIFSAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFF 127
            |:.|:||||.||..|.::|||..:.||||.|||:|:||:||.||.:.|....|:.||.||.|||.
  Fly    97 RRTLVVYNAFQVALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSKRMLNLCYLYYLSKLTEFA 161

  Fly   128 DTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMG 192
            ||.|||:||:..|::.|||.||.:.|:..|..|||..||::||...||.|||:.||.|||:||||
  Fly   162 DTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNATFPNLLNNFVHVCMYFYYMMAAMG 226

  Fly   193 PKVQKYLWWKKYLTVMQMIQFVLVMVHSFQLFFKNDCNYPIGFAYFIGA----HAVMFYFLFSNF 253
            |:..|:||||||:|.:|:.||||.:.|:.:..|.|.|.    |:.||.|    :|.:|:.||.||
  Fly   227 PEYAKFLWWKKYMTELQIAQFVLCIFHTLRALFSNQCQ----FSKFISALLLLNASIFFCLFMNF 287

  Fly   254 YKRAYVK 260
            |.::|.|
  Fly   288 YMQSYRK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 118/238 (50%)
CG33110NP_788716.1 ELO 61..294 CDD:279492 117/236 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449623
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.