DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and bond

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster


Alignment Length:291 Identity:113/291 - (38%)
Similarity:167/291 - (57%) Gaps:45/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWL----FYESCIGG 88
            |||||.|.:|:.|.|...|..:||:.|:||||.:|:::::.|||.||::|.|:    ..||.:..
  Fly    28 LMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTSIQESNVMA 92

  Fly    89 WLNGYNLRCEPVNYSYSPKAIRTAE-------GCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHV 146
            .:  ::.:|| :|        ||.|       |.|:|:|||..:..||.|||:||:.:|||.|||
  Fly    93 SI--FSKKCE-IN--------RTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHV 146

  Fly   147 IHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMI 211
            .||.|..:..|..:|:.||......|.||:.|||.||.|||:|||||:.|||||||||:|.:|:|
  Fly   147 YHHTITVLFSWGYLKYAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLI 211

  Fly   212 QFVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKD----------- 265
            ||||::.:...:..|. ||.|....:|...:.|:|.:||.|||::.|.|....|           
  Fly   212 QFVLILGYMLTVGAKG-CNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSVDGGSRTTGSSLA 275

  Fly   266 KASVKANG---------HANGHVKALKDGDV 287
            :::::|.|         :|..|:  |::|.|
  Fly   276 QSALRAAGGMGCMPQTMNAGKHL--LQNGQV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 106/259 (41%)
bondNP_651062.3 ELO 27..262 CDD:279492 105/245 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449620
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.