DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and CG5326

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster


Alignment Length:271 Identity:123/271 - (45%)
Similarity:174/271 - (64%) Gaps:8/271 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDYLTMFYDGWRDLMDNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKV 65
            :|.:..|:....||       ||:.:.|.::|.|...|...|.|.....||:.|.:||||||:..
  Fly    12 VDRMVNFFVEHEDL-------RTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNT 69

  Fly    66 LIVYNAAQVIFSAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTF 130
            |:||||.||:.|..||||...|||...||.:|:||.|...|.::|.|...|.||.:|.||..||.
  Fly    70 LLVYNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTV 134

  Fly   131 FFVMRKRYDQVSTLHVIHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKV 195
            |||:||:..|:|.||:.||.:|||..:.|||:..|||.|..||:|:|:||.|||||:|:||||||
  Fly   135 FFVLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKV 199

  Fly   196 QKYLWWKKYLTVMQMIQFVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVK 260
            |||||||||:|::|::||:::.||:.|:.|:.:||:|...|..:..:|.:|.::||.||...| |
  Fly   200 QKYLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYMFSAFYVANY-K 263

  Fly   261 RDGKDKASVKA 271
            ::...:|.:.|
  Fly   264 KEAAAQAKLAA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 115/238 (48%)
CG5326NP_651060.1 ELO 31..262 CDD:395916 113/230 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449650
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.