DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and CG16904

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster


Alignment Length:262 Identity:85/262 - (32%)
Similarity:131/262 - (50%) Gaps:27/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYESCIGGW-- 89
            ||..|...::.|...|...|..||.|||:..:..:||.||..||..||:|::.:|.      |  
  Fly    16 PLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFV------WGI 74

  Fly    90 -----LNGYNLRCEPVNYSYSPK--AIRTAEG--CWWYYFSKFTEFFDTFFFVMRKRYDQVSTLH 145
                 ...|||.|..|    .|:  .:::.|.  .:.|:.:|..:..||.|||:||:..|::.||
  Fly    75 HLLFVQKPYNLSCMQV----LPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLH 135

  Fly   146 VIHHGIMPVSVWWGVKFTP-GGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQ 209
            |.||..|..:....::|.. |||.......|..|||.||.||..::....||:.||||||||:.|
  Fly   136 VFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQ 200

  Fly   210 MIQFVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKASVKANGH 274
            ::||:|:.:|....:|:.:|:...|..|.|.:.:...:.:|:.||.:.|::     ...||:.|.
  Fly   201 LVQFLLMFLHCMYTYFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTYIR-----PKEVKSKGK 260

  Fly   275 AN 276
            .|
  Fly   261 VN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 81/250 (32%)
CG16904NP_649957.1 ELO 16..257 CDD:279492 82/255 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449632
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.