DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and Baldspot

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster


Alignment Length:271 Identity:61/271 - (22%)
Similarity:105/271 - (38%) Gaps:64/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YIVKVLGPK-LMENRKPFELRKVLIVYNAAQVIFSAW-----------------LFYESCIGGWL 90
            |::.:.|.: .|:||..|:||..||::|....:||..                 ||:..|:    
  Fly    45 YMLVIFGGQHFMQNRPRFQLRGPLIIWNTLLAMFSIMGAARTAPELIHVLRHYGLFHSVCV---- 105

  Fly    91 NGYNLRCEPVNYSYSPKAIRTAEGC----WWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVIHHGI 151
                           |..|.....|    |.:..||..|..||.|.|:||:  .:..||..||..
  Fly   106 ---------------PSYIEQDRVCGFWTWLFVLSKLPELGDTIFIVLRKQ--PLIFLHWYHHIT 153

  Fly   152 MPVSVWWG-VKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQFVL 215
            :.:..|:. .::|  ..:.:|..:|..||..||:||.|.|......:::  ...:|.:|:.|.::
  Fly   154 VLIYSWFSYTEYT--SSARWFIVMNYCVHSVMYSYYALKAARFNPPRFI--SMIITSLQLAQMII 214

  Fly   216 -----------VMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKASV 269
                       :..|.......:..|..:..|.:..     ::.||:.|:.:||:...|.....:
  Fly   215 GCAINVWANGFLKTHGTSSCHISQRNINLSIAMYSS-----YFVLFARFFYKAYLAPGGHKSRRM 274

  Fly   270 KANGHANGHVK 280
            .|:..|...||
  Fly   275 AASLAAQNVVK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 57/255 (22%)
BaldspotNP_648909.1 ELO 30..271 CDD:395916 57/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473089
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46589
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
87.900

Return to query results.
Submit another query.