DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl4a

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_957090.1 Gene:elovl4a / 393769 ZFINID:ZDB-GENE-040426-1767 Length:309 Species:Danio rerio


Alignment Length:282 Identity:118/282 - (41%)
Similarity:176/282 - (62%) Gaps:10/282 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYE 83
            :|.|...:|||.||.||:|||.:|...: .||||.|:.|:||:|||.||:||.:.||.:.::|.|
Zfish    22 ADKRVEKWPLMDSPLPTLAISSSYLLFL-WLGPKYMQGREPFQLRKTLIIYNFSMVILNFFIFKE 85

  Fly    84 SCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVIH 148
            ..:......|:..|:||:||..|..:|.|...|||:.||..|:.||.||::||:::|:|.|||.|
Zfish    86 LFLAARAANYSYICQPVDYSDDPNEVRVAAALWWYFISKGVEYLDTVFFILRKKFNQISFLHVYH 150

  Fly   149 HGIMPVSVWW-GVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQ 212
            |..| .::|| |:|:..||.|.|...:|..:|:.||.||.|||.|||:||:||||||||::||:|
Zfish   151 HCTM-FTLWWIGIKWVAGGQSFFGAHMNAAIHVLMYLYYGLAAFGPKIQKFLWWKKYLTIIQMVQ 214

  Fly   213 FVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKASVKANGHANG 277
            |.:.:.|: .|...:||.:|....:.:..:|:.|..||.|||.:.|.::..:||.....||.:||
Zfish   215 FHVTIGHT-ALSLYSDCPFPKWMHWCLIGYALTFIILFGNFYYQTYRRQPRRDKPRALHNGASNG 278

  Fly   278 HVKALKDGDVA-----PTSNGQ 294
            .:.: .:|:.|     |..:|:
Zfish   279 ALTS-SNGNTAKLEEKPAESGR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 106/239 (44%)
elovl4aNP_957090.1 ELO 30..267 CDD:279492 106/239 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.