DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl5

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_956747.1 Gene:elovl5 / 393425 ZFINID:ZDB-GENE-040407-2 Length:291 Species:Danio rerio


Alignment Length:299 Identity:114/299 - (38%)
Similarity:159/299 - (53%) Gaps:39/299 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FYDGW---RDLMDNKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIV 68
            :.|.|   |||       |...:.|:....||...::.|..|| .:|||.|:||:.:..|.:|:.
Zfish    11 YIDSWMGPRDL-------RVTGWFLLDDYIPTFIFTVMYLLIV-WMGPKYMKNRQAYSCRALLVP 67

  Fly    69 YNAAQVIFSAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFV 133
            ||....:.|.::|||..:..:..|||..|:. .:|......|.....|||||||..||.|||||:
Zfish    68 YNLCLTLLSLYMFYELVMSVYQGGYNFFCQN-THSGGDADNRMMNVLWWYYFSKLIEFMDTFFFI 131

  Fly   134 MRKRYDQVSTLHVIHHGIMPVSVWWGV-KFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQK 197
            :||...|::.|||.||..| :::||.| .:.|.|||.|....|:|:|:.||:||.|:|: |.::.
Zfish   132 LRKNNHQITFLHVYHHATM-LNIWWFVMNWVPCGHSYFGATFNSFIHVLMYSYYGLSAV-PALRP 194

  Fly   198 YLWWKKYLTVMQMIQFVLVMVHSFQLFFKND------CNYPIGFAYFIGAHAVMFYFLFSNFYKR 256
            |||||||:|..|::||||.|       |:..      |.:|:|:.||..::.|....||||||.:
Zfish   195 YLWWKKYITQGQLVQFVLTM-------FQTSCAVVWPCGFPMGWLYFQISYMVTLILLFSNFYIQ 252

  Fly   257 AYVKRDGKDKASV---KANGHANG--------HVKALKD 284
            .|.||.|..|:..   ..|||.||        |.||..|
Zfish   253 TYKKRSGSRKSDYPNGSVNGHTNGVMSSEKIKHRKARAD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 98/245 (40%)
elovl5NP_956747.1 ELO 27..262 CDD:279492 98/245 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.