DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and Elo68beta

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster


Alignment Length:246 Identity:99/246 - (40%)
Similarity:144/246 - (58%) Gaps:14/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYE 83
            :|.||:|:||:.||:..||:...|..:|: ..||.....||.:||..|..::.|.:..:.::..|
  Fly    22 ADERTQDWPLVKSPWNIIALLALYLLMVR-YAPKWTARCKPLQLRVPLFCHSLAMIFLNGYICLE 85

  Fly    84 SCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVIH 148
            ........|||..|:....|:.|..||.|...||:|.||..||.||.||::|.:::|:|.|||.|
  Fly    86 FLTASLSLGYNFACQECRVSHDPHEIRIAAAMWWFYISKILEFVDTAFFILRHKWNQLSFLHVYH 150

  Fly   149 HGIMPVSVWWGVKFTPGGHSTFF-GFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQ 212
            |..|.:..|..||:.|.| |||| ..:|:|||:.||:||.|:.:||:||::||||:|||.:|::|
  Fly   151 HSTMFLFCWTYVKWLPTG-STFFPSMINSFVHVIMYSYYALSVLGPRVQRFLWWKRYLTGLQLVQ 214

  Fly   213 FVLVMVHSFQLFFKNDCNY-----PIGFAYFIGAHAVMFYFLFSNFYKRAY 258
            |.::...:.||.|:. |.|     |||.||.     |.|.|:|..||.:.|
  Fly   215 FTIIFFWASQLVFRG-CEYGKWLTPIGAAYM-----VPFLFMFGRFYAQKY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 95/238 (40%)
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 88/220 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473091
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100254
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
1211.830

Return to query results.
Submit another query.