DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and CG18609

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster


Alignment Length:266 Identity:89/266 - (33%)
Similarity:135/266 - (50%) Gaps:26/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFS----A 78
            ::||  ...||..||:|...|.:.|...|..||...|.||||::|:.||.|||..||:::    .
  Fly     9 QADP--NPIPLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFG 71

  Fly    79 WLFYESCIGGWLNGYNLRCEPVNYSYS--PKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQV 141
            .:||...|.|..|.:.:...|..:...  .:.:..|     |..:|..:..||.|||:||.|.|:
  Fly    72 MVFYYLFIVGICNLHCIESFPEGHERKQLERVLHAA-----YLLNKVLDLMDTVFFVLRKSYKQI 131

  Fly   142 STLHVIHH-----GIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWW 201
            :.||:.||     |...::.::|.    |||....|.||:.||..||.||.|::..|.|:..:||
  Fly   132 TFLHIYHHVFMSFGSYALTRYYGT----GGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRANIWW 192

  Fly   202 KKYLTVMQMIQFVLVMVHSFQL-FFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKD 265
            |||:|:.|:.||.:::.::..: ||..:|..|.|..|......|:|.:||..||...|::   ..
  Fly   193 KKYITLTQLCQFFMLLSYAIYVRFFSPNCGVPRGLLYLNMVQGVVFIYLFGKFYIDNYLR---PP 254

  Fly   266 KASVKA 271
            ||.:.|
  Fly   255 KAKINA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 84/250 (34%)
CG18609NP_611365.2 ELO 16..257 CDD:279492 85/252 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449638
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
1110.930

Return to query results.
Submit another query.