DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl4b

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_956266.1 Gene:elovl4b / 335732 ZFINID:ZDB-GENE-030131-7672 Length:303 Species:Danio rerio


Alignment Length:289 Identity:123/289 - (42%)
Similarity:170/289 - (58%) Gaps:14/289 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYE 83
            :|.|...:|:||||.||:.||:.|...:.. ||..|:||:||:|||.|||||.:.|:.:.::..|
Zfish    22 ADKRVEKWPMMSSPLPTLGISVLYLLFLWA-GPLYMQNREPFQLRKTLIVYNFSMVLLNFYICKE 85

  Fly    84 SCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVIH 148
            ..:|....||:..|:|||||.....:|.|...||||.||..||.||.||:|||:::|||.|||.|
Zfish    86 LLLGSRAAGYSYLCQPVNYSNDVNEVRIASALWWYYISKGVEFLDTVFFIMRKKFNQVSFLHVYH 150

  Fly   149 HGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQF 213
            |..|.:..|.|:|:.|||.|.|...:|:.:|:.||.||.|||.|||:|||||||||||::|||||
Zfish   151 HCTMFILWWIGIKWVPGGQSFFGATINSGIHVLMYGYYGLAAFGPKIQKYLWWKKYLTIIQMIQF 215

  Fly   214 VLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKASVKANG---HA 275
            .:.:.|:....: ..|.:|....:.:..:||.|..||:|||.:.|.::.....|....||   ..
Zfish   216 HVTIGHAAHSLY-TGCPFPAWMQWALIGYAVTFIILFANFYYQTYRRQPRLKTAKSAVNGVSMST 279

  Fly   276 NGHVKALKDGDVAPTSNG----QANGFHN 300
            ||..|..:     .|.||    :..|.|:
Zfish   280 NGTSKTAE-----VTENGKKQKKGKGKHD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 110/238 (46%)
elovl4bNP_956266.1 ELO 30..266 CDD:279492 110/237 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.