DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and CG31141

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_732912.2 Gene:CG31141 / 318605 FlyBaseID:FBgn0051141 Length:253 Species:Drosophila melanogaster


Alignment Length:250 Identity:88/250 - (35%)
Similarity:133/250 - (53%) Gaps:16/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWL----FYE 83
            ::..||.:.|.|.|.|.:.|..:|...|.|.||:|:|:.|||||..||..|:.::..:    :|.
  Fly    12 SKQLPLATGPGPIIIILIGYLLVVFKAGRKFMEHREPYNLRKVLKYYNMFQIFYNIMMLLPGYYF 76

  Fly    84 SCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGC--WWYYFSKFTEFFDTFFFVMRKRYDQVSTLHV 146
            ..:   ...||.||..|.....|  ::..|.|  :.||.:|..:..||.|.|:||:|.|::.|||
  Fly    77 MLV---FQPYNFRCMTVLQQDHP--LKNWERCISYAYYINKIVDLLDTVFCVLRKKYSQITFLHV 136

  Fly   147 IHHGIMPVSVWWGVKFTP-GGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQM 210
            .||.:||.:.:..::|.. ||...|....|.||||||||||..|..|..|:    ||:|||:|||
  Fly   137 FHHVLMPSAGYLIIRFYGYGGQLFFLCSFNVFVHIFMYAYYYSAIKGNTVR----WKRYLTLMQM 197

  Fly   211 IQFVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKD 265
            :||:|:..|......:..|....|..:.:...|.:.:.:|:|||.:.|::...|:
  Fly   198 LQFLLMFGHCALTAMQRQCTASQGTLFLVSCSATIMFIMFANFYFQCYLRPKHKE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 88/245 (36%)
CG31141NP_732912.2 ELO 34..253 CDD:279492 81/227 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449647
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.